PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC032977.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family ZF-HD
Protein Properties Length: 339aa    MW: 37971.4 Da    PI: 8.2385
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC032977.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer1001.7e-31126181359
   ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                   ++rY+eCl+NhAas+Ggh vDGCgEfmps geegt+  ++CaAC+CHRnFHR+ev+ 
  EcC032977.10 126 SIRYRECLRNHAASMGGHIVDGCGEFMPS-GEEGTPGYFRCAACECHRNFHRKEVDG 181
                   689*************************9.999*********************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-20122182IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.4E-29127179IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.0E-28128179IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.382129178IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.18E-16270336IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-26270337IPR009057Homeodomain-like
PROSITE profilePS500718.6273337IPR001356Homeobox domain
TIGRFAMsTIGR015651.4E-25275332IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MELGDQEQER EMPSSLGYTP PHKDSSSKFS AANRRDQTLG QPNHLYPQNH HPPNPHQLAN  60
KPRREYQETD QDPFAVASPS PIAVATGGTS VSIKPHTEPP SPPQGQLTQS PTPQPESVTA  120
LISASSIRYR ECLRNHAASM GGHIVDGCGE FMPSGEEGTP GYFRCAACEC HRNFHRKEVD  180
GEPQYTPSLY YSSNKTNGQR AALPPPQQHH AIPHPNPINL HHRFSYCISS AATTMTTAPN  240
QPVMMAFGGG FPEESSSEDL TMIQHSDAVL RSTQKKRFRT KFTQQQKDKM MECAEKLGWR  300
IQKQDEQEVI QFCTEAGVTR KAFKVWMHNN KQAMKKQQR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-202763331875ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010029792.10.0PREDICTED: zinc-finger homeodomain protein 6
TrEMBLA0A059ASS90.0A0A059ASS9_EUCGR; Uncharacterized protein
STRINGPOPTR_0007s12970.14e-87(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.16e-57homeobox protein 24